PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA33383
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CO-like
Protein Properties Length: 350aa    MW: 39067.8 Da    PI: 6.443
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA33383genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.52.4e-07751240
                   zf-B_box  2 eerkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                               ++r C+ +++  + l+C+ ++  lC +C  e H+       Ht++
  Tp57577_TGAC_v2_mRNA33383  7 NPRPCDYCGHSTAVLYCRADSAKLCFSCDREVHSTnqlfskHTRS 51
                               6789******99*********************668888888876 PP

2zf-B_box24.74.9e-085295442
                   zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                                +C+ +++ ++++ C + ++ +C++C  e+H +      H+++pl
  Tp57577_TGAC_v2_mRNA33383 52 LICDSCDDSPATILCSTESSVFCQNCDWEKH-NlslsspHERRPL 95
                               69*****************************.6688889988775 PP

3CCT63.56.4e-22305347143
                        CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                                R+ allRYk+K+ktR+++K+irYesRK++Ae+R RvKGrF+k 
  Tp57577_TGAC_v2_mRNA33383 305 RDSALLRYKQKKKTRRYDKHIRYESRKVRAETRTRVKGRFAKI 347
                                899**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.2E-15653IPR000315B-box-type zinc finger
PROSITE profilePS5011910.367653IPR000315B-box-type zinc finger
PfamPF006435.6E-6751IPR000315B-box-type zinc finger
CDDcd000216.72E-8953No hitNo description
PROSITE profilePS5011910.314995IPR000315B-box-type zinc finger
PfamPF006434.0E-65295IPR000315B-box-type zinc finger
CDDcd000212.80E-55395No hitNo description
SMARTSM003360.0935495IPR000315B-box-type zinc finger
PfamPF062038.1E-16305346IPR010402CCT domain
PROSITE profilePS5101714.545305347IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MGGSPKNPRP CDYCGHSTAV LYCRADSAKL CFSCDREVHS TNQLFSKHTR SLICDSCDDS  60
PATILCSTES SVFCQNCDWE KHNLSLSSPH ERRPLEGFTG CPSVTELLSI LGLQDIGKKS  120
LLLPQESVGD GYVGYEIEGL SDLFVWDAPT FVSLDDLIST SPSSHNYSAM EVPPLPKNRK  180
AACGRHREEI LNQLRGLTKS EPYDPEEYIP PTNLSIGFER DVKADIVPSN EWLRESSEPM  240
YQVVPDTSFI AHTEDIPVNH SVSAVGEPHT HGNNEGTPSE SLKSEILSTT PKAVPPPYEI  300
ASQERDSALL RYKQKKKTRR YDKHIRYESR KVRAETRTRV KGRFAKIEH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1313319QKKKTRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1980070.0AC198007.2 Medicago truncatula chromosome 7 BAC clone mth2-54m23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625866.10.0zinc finger constans-like protein
TrEMBLG7KQZ20.0G7KQZ2_MEDTR; Uncharacterized protein
STRINGGLYMA19G39460.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70553145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47890.12e-96B-box type zinc finger protein with CCT domain